General Information

  • ID:  hor003541
  • Uniprot ID:  A0A7M7G9B6(23-41)
  • Protein name:  Periviscerokinin-like
  • Gene name:  100577997
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Periviscerokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  EKLKPNMRRAFGLLTYPRI
  • Length:  19(23-41)
  • Propeptide:  MRNHLFVFLVVLSIFSVSLNRGEKLKPNMRRAFGLLTYPRIGRSNAPISNLNFNRRGVESDTDFQFYSAELDPAPDKDYEDSPAPKSLGRSMHAKHADRIPKEASWLISDRPRSSKDGSWKIDEGRSIYPFLLNSDSRNSQVNGYTPTRLDRRGNDADRILRK
  • Signal peptide:  MRNHLFVFLVVLSIFSVSLNRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7G9B6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003541_AF2.pdbhor003541_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 262503 Formula: C105H175N31O25S
Absent amino acids: CDHQSVW Common amino acids: LR
pI: 11.58 Basic residues: 5
Polar residues: 4 Hydrophobic residues: 6
Hydrophobicity: -60.53 Boman Index: -4426
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 87.37
Instability Index: 2527.37 Extinction Coefficient cystines: 1490
Absorbance 280nm: 82.78

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera